Products

IL-4 (Interleukin-4), Swine

The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th2 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13.
No. Size Price Qty Status
C03004-5UG 5 ug $120.00 Inquiry
C03004-20UG 20 ug $300.00 Inquiry
C03004-100UG 100 ug $594.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKD
FLERLKTIMKEKYSKC with polyhistidine tag at the C-terminus

UnitProt ID:
Q04745
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL.
 
Purity:
>98% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping conditions:
Blue ice
Reviews for IL-4 (Interleukin-4), Swine

Average Rating: 0 (0 Reviews )